UNFUCG
DashboardSearchChatBookmarksNotificationsActivityPremiumProfile
?
Home
Search
Chat
Saved
Profile
Episode
ATP Collapse: Why Modern Life Makes You Tired
~68 min
Episode Brief·YouTube

ATP Collapse: Why Modern Life Makes You Tired

Siim Land
Watch on YouTube Add to chat My bookmarks← All sources

TL;DR

The four things you'd lose by not watching

4 items

TL;DR

The four things you'd lose by not watching

4 items
1

Low energy is primarily caused by dysfunctional mitochondria that fail to produce and recycle ATP efficiently; three fixes are increasing mitochondrial numbers (biogenesis), improving their efficiency, and clearing worn-out ones via mitophagy.

2

Exercise is the most powerful tool: high-intensity interval training (90–95% max HR) stimulates biogenesis markers like PGC1-alpha, while low-intensity aerobic work boosts mitochondrial density and NAD production, and resistance training aids TFAM. Aim for at least 2 resistance sessions and 1 aerobic session weekly.

3

Sustained energy requires a working NAD salvage pathway, which is bottlenecked by the enzyme NAMPT and governed by circadian rhythm alignment. Taking NAD precursors like NMN or NR gives only short-term energy unless you have proper sleep-wake timing, sunlight exposure, and darkness at night.

4

Nutrient deficiencies—especially CoQ10, taurine, selenium, B12, copper, magnesium, and iron—break the electron transport chain. Eat organ meats, seafood, nuts, seeds, leafy greens, and dark chocolate; manage iron by sex: women often need more via copper, while men may benefit from blood donation to lower age-accelerating iron/lipofuscin.

Protocols

Concrete recipes — what, when, how much, and why

8 items

Mitochondrial Biogenesis and Efficiency Exercise Plan

WhatIncorporate at least two resistance training sessions and one aerobic session per week, mixing high-intensity intervals (90–95% max HR) with low-to-moderate-intensity steady-state work for different mitochondrial adaptations.
WhenWeekly; distribute sessions across the week. Avoid overtraining (several hours daily) that depletes NAD.
DoseFrom meta-analysis: HIIT at 90–95% max HR interspersed with 50–70% HR for 12 weeks strongly increased PGC1-alpha and TFAM. Low-intensity aerobic (e.g., 45–60 min at comfortable pace) boosts mitochondrial density and efficiency. Resistance training at least twice a week for TFAM.
For whomGenerally healthy adults; adjust intensity by fitness level.
WhyExercise stimulates AMPK, PGC1-alpha, and NRF2 pathways to trigger mitochondrial biogenesis. Low-intensity aerobic work improves the efficiency of existing mitochondria, and resistance training activates transcription factors like TFAM.
CaveatsOvertraining (prolonged high-intensity near failure) actually lowers NAD levels and increases fatigue, especially if the salvage pathway is impaired. Moderate and consistent training is key.

Land notes that most people in the modern world simply don't move enough, leading to a downward spiral of low mitochondrial density, poor energy production, and chronic fatigue. By implementing a structured exercise regimen, you force the body to adapt: it senses an energy deficit (AMPK activation) and builds more power plants. He distinguishes between training types: HIIT is superior for the signaling molecules that initiate biogenesis (PGC1-alpha, TFAM), while low-intensity aerobic work excels at improving how much energy each mitochondrion can produce per unit of oxygen. Resistance training also raises TFAM, giving a complementary boost. A balanced approach covering all three ensures both quantity and quality of mitochondria, translating to steady daytime energy without relying on stimulants.

Mechanism

High-intensity exercise creates acute energy stress, signaling through AMPK to upregulate PGC1-alpha, the master regulator of mitochondrial biogenesis. PGC1-alpha then activates NRF2 and TFAM (mitochondrial transcription factor A), which promote replication of mitochondrial DNA and assembly of new electron transport chain complexes. Low-intensity aerobic training predominantly uses slow-twitch fibers with aerobic metabolism, enhancing the oxidative capacity and density of mitochondria without excessive stress. Resistance exercise boosts TFAM, contributing to mitochondrial quality and function in muscle tissue.

Paradoxically, exercising regularly will increase your energy and you'll feel less tired during the daytime. That's because your mitochondria are working more efficiently and you have more mitochondria to begin with.

Also said
“A 2022 meta analysis saw that high-intensity interval training for 12 weeks at 90 to 95% of max heart rate interspersed with 50 to 70% heart rate was most effective for increasing PGC1 alpha and TFAM.”— Provides a specific, recent reference for the recommended HIIT protocol.
“Low and moderate intensity aerobic exercise is superior for mitochondrial density and efficiency. You're able to produce more energy from the same amount of mitochondria.”— Explains why steady-state cardio is still essential, despite HIIT's popularity.
“Exercising close to failure and at very high intensities for too long actually lowers NAD levels which is why overtraining makes you feel more tired.”— Caveat that too much high-intensity work backfires by draining NAD.

Time-Restricted Eating Before Bed

WhatStop eating all food 3 to 4 hours before bedtime.
WhenDaily in the evening; align the last meal so that digestion is complete well before sleep.
Dose3–4 hour fasting window before sleep.
For whomMost adults; those with specific metabolic conditions may need to adjust.
WhyExtends the overnight fast, activates AMPK, and promotes mitophagy (clearance of damaged mitochondria). Also supports circadian rhythm alignment by avoiding nocturnal eating.
CaveatsNone mentioned explicitly beyond individual tolerance; the advice is general.

Land points out that mitophagy declines with age, leading to accumulation of lipofuscin-laden, malfunctioning mitochondria. Time-restricted eating, combined with exercise and polyphenol intake, is a practical way to sustain a healthy mitochondrial pool. He ties this to the broader theme of autophagy as quality control: if you never let the cell 'take out the trash,' the buildup of cellular junk—particularly iron-rich lipofuscin—promotes senescence and chronic fatigue. By simply closing the kitchen a few hours before bed, you extend the overnight fasting window, giving your cells a longer cleanup phase.

Mechanism

Fasting inhibits insulin and mTOR, and activates AMPK, a key energy sensor that triggers autophagy. Mitophagy, specifically, is the selective degradation of worn-out mitochondria by lysosomes. During the fasting period, the body upregulates mitophagy to remove dysfunctional mitochondria that would otherwise leak reactive oxygen species and drive inflammation. Polyphenols and exercise also synergize, but time-restricted eating provides a daily circadian cue that amplifies the process.

Timerestricted eating is beneficial for mitochondrial health by increasing mitochondrial density and mphagy that eliminates old worn out mitochondria.

Also said
“Stop eating a few hours before bed to keep your circadian rhythms aligned.”— Connects the fasting window to circadian synchronization, not just caloric restriction.

Circadian Light and Dark Routine for NAD Recycling

WhatWake up and get bright daylight exposure immediately; avoid artificial blue light from screens before bed; sleep in complete darkness; aim to be in bed before midnight.
WhenEvery day. Morning: sunlight within first hour of waking. Evening: block blue light starting at least 1–2 hours before bed.
DoseMorning light: as soon as possible after waking, ideally while sun is still low. Evening: no specific duration, but avoid bright screens and use amber lights or blue-blockers. Sleep in pitch black.
For whomAnyone experiencing fatigue or wanting sustained energy; especially crucial for shift workers or those with irregular schedules.
WhyLight exposure sets the suprachiasmatic nucleus (master circadian clock), which controls the cortisol-melatonin rhythm and, most critically, the expression of SIRT1 and NAMPT, the bottleneck enzyme for the NAD salvage pathway. Without this alignment, NAD recycling is crippled, causing fatigue even with adequate sleep.
CaveatsGenetic chronotypes exist, but most people who think they are night owls actually suffer from light-induced circadian disruption. A 3 a.m. bedtime with an 11 a.m. wake-up is not optimal even if total sleep hours are the same.

Land frames circadian misalignment as the single biggest hidden cause of fatigue in the modern world. He argues that even people who sleep 7–8 hours can feel exhausted if their rhythm is out of sync because their bodies cannot recycle NAD properly. The vicious cycle: blue light at night suppresses melatonin, shifts the sleep-wake cycle later, and blunts the morning cortisol rise, causing them to wake up tired and rely on caffeine. Over time, this desynchronizes the entire hormonal orchestra. By implementing a simple light/dark schedule—sunlight upon waking, outdoor light during the day, no eating or exercise late at night, and darkness during sleep—the circadian system recalibrates, allowing SIRT1/NAMPT to operate at full capacity, which sustains NAD and energy without stimulants.

Mechanism

The SCN receives light signals from the retina, suppressing melatonin during the day and coordinating peripheral clocks in organs. SIRT1, an NAD-dependent deacetylase, links the core clock to metabolism: it regulates NAMPT, which recycles nicotinamide into NMN, feeding the salvage pathway. When you see bright light in the morning, cortisol spikes to promote wakefulness and initiates a cascade that supports NAD synthesis. At night, darkness allows melatonin to rise, which supports antioxidant defense and autophagy. Artificial blue light at night sends a 'daytime' signal to the SCN, delaying melatonin, disrupting NAMPT transcription, and flipping the cortisol rhythm, leading to morning grogginess despite sufficient sleep duration.

The most critical component of NAD recycling is circadian rhythm alignment because NAMPT the bottleneck in how much NAD gets produced is dependent of SIRT1 expression the protein that governs circadian rhythm regulation.

Also said
“Circadian rhythm misalignment is a big reason people feel tired in the morning and during the day. They're not producing enough cortisol in the morning and their hormones are out of sync.”— Links the circadian protocol directly to the feeling of morning fatigue.
“When you get exposed to blue light before bed, you experience circadian disruption that makes everything in your body out of sync. That's why you feel tired in the morning and energized before bed.”— Explains the common experience of 'wired but tired' at night.
“The proper human circa rhythm is that we get exposed to bright lights in the morning. We're physically active during the day. We eat our food during the day and we block out artificial light before bed and sleep in complete darkness.”— Simple summary of the ideal daily rhythm.

Caffeine Cut-off at 2 p.m.

WhatConsume caffeine (coffee, tea, etc.) only before 2 p.m. to prevent it from disrupting sleep.
WhenDaily; last caffeine no later than early afternoon.
DoseHalf-life of caffeine is about 6 hours; avoid any caffeine after 2 p.m. to ensure it is mostly cleared by bedtime. Slow metabolizers should be even more cautious.
For whomAll coffee drinkers who experience sleep issues or afternoon fatigue. Fast metabolizers (genetic) may tolerate later intake but should still be cautious.
WhyCaffeine blocks adenosine receptors, masking fatigue rather than curing it. If caffeine remains in your system at night, it fragments sleep quality and delays sleep onset, worsening the very fatigue you're trying to fix.
CaveatsSome people are genetically slow metabolizers and may need to stop caffeine well before noon. Even if you fall asleep after evening coffee, sleep architecture can be impaired.

Land acknowledges that coffee polyphenols can support mitophagy and NAD recycling, so coffee itself isn't bad. The problem arises when dependence on caffeine masks chronic fatigue and when late-day consumption sabotages sleep. He suggests keeping caffeine to the morning and early afternoon to reap the polyphenol benefits without the sleep penalty. He also notes that people who feel they 'need' coffee to function are likely covering up an underlying mitochondrial or circadian problem that caffeine alone won't solve.

Mechanism

Adenosine builds up during waking hours as a byproduct of ATP breakdown, creating 'sleep pressure'. Caffeine antagonizes adenosine A2A receptors, blocking the signal that tells you to rest. Once caffeine is metabolized, adenosine surges, often causing a crash. The 6-hour half-life means that one cup at 4 p.m. leaves 50% still active at 10 p.m., interfering with deep sleep and the circadian-driven NAD recycling that occurs during rest.

Generally keep your caffeine consumption before 2 p.m. to not interfere with your sleep.

Also said
“Caffeine works by blocking adenosine receptors in the brain, masking the feeling of tiredness. You're actually not untired, but your brain just hides the feeling of tiredness.”— Clarifies that caffeine isn't a true energy source but a mask.
“The half-life of caffeine is 6 hours which means it can stay in your system 24/7 if you drink several cups of coffee a day, especially in the afternoon.”— Warns about caffeine accumulation from multiple daily cups.

Iron and Copper Optimization by Sex

WhatWomen: ensure dietary iron and copper from red meat, liver, dark chocolate, beans. Men: consider periodic blood donation to lower iron if levels are high, and avoid excess iron supplementation.
WhenAs indicated by blood work; general dietary guidance daily.
DoseNo specific doses given; emphasizes food sources and blood donation annually or as recommended by doctor.
For whomMen, especially middle-aged and older, who may have high ferritin. Premenopausal women who feel tired and may have anemia, particularly if their diet is low in copper-rich foods.
WhyIron drives lipofuscin formation and aging when in excess, but women lose iron through menstruation and often become deficient. However, deficiency is frequently secondary to low copper, which is needed for ceruloplasmin to mobilize iron. Men, lacking menstruation, tend to accumulate iron, which accelerates cardiovascular aging and mitochondrial damage.
CaveatsIron supplementation should be guided by blood tests; excess iron is pro-aging. Women with heavy periods may need more iron but should also check copper status.

Land describes lipofuscin as 'aging pigment' visibly seen as liver spots, loaded with iron that drives oxidative stress and senescence. He stresses that the common advice to take iron for fatigue may backfire, especially in men who already have sufficient or excessive iron. Instead, he advises a focused dietary approach: liver and dark chocolate for copper, red meat and leafy greens for iron, and for men, therapeutic phlebotomy (blood donation) as a longevity tool. This segment ties together mitochondrial health, nutrient status, and aging biology into a practical, sex-specific protocol.

Mechanism

Ceruloplasmin, a copper-dependent enzyme, oxidizes iron to its transportable form. Without copper, iron gets trapped in tissues and can't be used for hemoglobin, leading to anemia even with adequate iron stores. On the flip side, excess iron accumulates in mitochondria and contributes to lipofuscin, a non-degradable pigment that produces reactive oxygen species and triggers cellular senescence. Periodic blood removal lowers iron burden and reduces lipofuscin formation, potentially slowing aging.

High iron levels in the blood promote aging through lipofuskin accumulation and chronic inflammation. However, you need a certain amount of iron to avoid iron deficiency anemia.

Also said
“Iron deficiency anemia isn't always because of low iron levels. It's more often than not because of low copper. Ceruopo plasmine is a copper carrying protein that increases iron absorption and iron transportation.”— Directly advises looking at copper before blindly supplementing iron.
“Men might actually need to lower their iron levels with blood donation ... women are more commonly deficient in iron and copper because of menstruation.”— Sex-specific action steps.

Niacinamide/Niacin for Long-Term NAD Support

WhatTake niacinamide or niacin as an NAD precursor instead of NMN or NR, because these forms feed the salvage pathway more directly.
WhenDaily; timing not specified but likely with food to avoid stomach upset.
DoseNo specific dose given; typical anti-aging doses of niacinamide range from 250–500 mg but the speaker does not prescribe.
For whomThose looking for sustained energy and NAD optimization, especially if they have studied the NAD field and want to avoid the limitations of NMN.
WhyNiacinamide is converted to NMN by NAMPT, which is the enzyme that limits NAD recycling. Providing niacinamide supports the endogenous recycling machinery, whereas NMN/NR bypass the salvage step and do not upregulate NAMPT. This aligns with the philosophy of fixing the root cause (salvage pathway) rather than just pouring in direct precursors.
CaveatsNiacin can cause a flushing sensation at higher doses. Niacinamide rarely does. Still, the most important factor is circadian rhythm alignment; supplements alone won't work if the salvage pathway is not operational.

Land emphasises that while NMN and NR do elevate NAD, they are essentially fast-acting but temporary boosts. Niacinamide or niacin, he argues, are better for long-term, sustainable NAD levels because they work with the body's own regulatory system. He is careful to say that all these supplements work, but the hierarchy of effectiveness depends on the health of the salvage pathway. Ultimately, he returns to the circadian point: even the best supplement is useless without proper light-dark cycling to activate NAMPT.

Mechanism

In the salvage pathway, nicotinamide (niacinamide) is the direct substrate for NAMPT, which converts it to NMN. NMN then goes to NAD via NMNAT. By supplying niacinamide, you feed the very pathway that is physiologically rate-limiting, potentially upregulating NAMPT over time. NMN/NR, on the other hand, enter distal to NAMPT and may even suppress the body's own recycling machinery by providing NAD without the cellular energy stress that stimulates NAMPT.

I think if you take an NAD supplement then ninamide or nascin are much better and more suitable for long-term NAD production.

Also said
“NMN or NR don't fix the salvage pathway. They do raise NAD levels in the short term, but to be able to recycle that energy, you need to have the salvage pathway working properly.”— Explains the core limitation of popular NAD supplements.

Methylene Blue as a Short-Term Mitochondrial Bypass

WhatUse methylene blue to temporarily support ATP production when one or more mitochondrial complexes are broken, such as in cases of toxin exposure, neurodegeneration, or inherited mitochondrial disease.
WhenOnly under specific conditions of mitochondrial dysfunction; not for daily energy enhancement in healthy people.
DoseNot specified; medical supervision implied.
For whomIndividuals with diagnosed mitochondrial complex deficiencies; not for healthy people seeking an energy boost.
WhyMethylene blue can accept electrons and donate them directly to complex IV, bypassing dysfunctional complexes I and III, keeping ATP flowing when the electron transport chain is damaged.
CaveatsIn healthy individuals with fully functioning mitochondria, it provides no benefit and Siim Land personally noticed no effect. It should be reserved as a medical tool, not a nootropic.

Land mentions it in the context of severe mitochondrial damage—cyanide poisoning, certain chronic diseases. He cautions that many people are experimenting with methylene blue as a biohack, but based on his own trial, it did nothing for him. This underscores a recurring theme: fix the mitochondrial machinery through lifestyle (exercise, circadian rhythm, nutrients) rather than reaching for exotic pharmacological bypasses that only help when the underlying machine is broken.

Mechanism

Methylene blue crosses mitochondrial membranes and acts as a redox cycler. It can accept electrons from NADH (upstream of complex I) and transfer them directly to cytochrome c (complex IV), bypassing the need for complexes I and III. This maintains the proton gradient and ATP synthase activity even when those complexes are inhibited. However, if complexes I and III are working, methylene blue simply provides a redundant route that does not increase overall ATP output.

Personal experience

I've taken methylene blue before, and I didn't notice an effect because my mitochondria are already working optimally.

Methylene blue might come in handy as a short-term band-aid to support energy production when one of these mitochondrial complexes isn't working.

Also said
“I've taken methylene blue before, and I didn't notice an effect because my mitochondria are already working optimally.”— First-hand anecdotal evidence that it's useless for healthy mitochondria.

Optimize Sleep Duration

WhatAim for 7–8 hours of sleep per night; if still tired, try extending to 8 or 9 hours to see if you are simply under-slept.
WhenNightly.
Dose7–8 hours for most; individual variation exists, some function well on 6, others need 9. Experiment.
For whomEveryone; those who feel unrested despite lifestyle improvements.
WhySleep clears adenosine (the sleep pressure molecule) and allows the brain to reset fatigue; insufficient sleep leaves you with high adenosine in the morning.
CaveatsSleep quality matters more than quantity; if circadian rhythm is misaligned, even 8 hours won't feel restorative.

Land places sleep as the 'reset button' for fatigue. Even with perfect mitochondria and circadian alignment, if total sleep time is chronically insufficient, energy will suffer. He advises simply trying to sleep longer if you're still tired despite 7 hours, because individual needs vary.

Mechanism

During wakefulness, ATP breakdown in the brain produces adenosine, which binds to receptors and generates sleep pressure. Deep sleep clears adenosine, lowering sleep pressure. Inadequate sleep means adenosine hasn't been fully cleared, so you wake up already tired.

If 7 hours isn't enough, sleep for eight and see what happens.

What's new

Personal practice updates, fresh positions, predictions

4 items

NAD salvage pathway depends on circadian rhythm, not just precursors

Long-term energy production relies on the NAD salvage pathway, whose rate-limiting enzyme NAMPT is controlled by circadian clock proteins; simply taking NMN or NR fails without proper light/dark alignment.

Why this matters: Challenges the common biohacker assumption that NMN/NR alone solves low energy, reframing it as a lifestyle problem of circadian disruption.

Background

Many people supplement with NMN or NR expecting a permanent energy boost. Siim Land argues that while they raise NAD temporarily, they do not repair the underlying recycling machinery, which is the main source of daily NAD (salvage pathway). Without circadian synchronization, NAMPT stays low and the supplements become a short-term band-aid.

Land further explains that even dietary niacinamide or niacin (not just NMN) can feed the salvage pathway, but the real fix is the circadian alignment. He points out that shift work and circadian misalignment are linked to chronic disease and fatigue even when people sleep 7–8 hours, precisely because the NAD recycling machinery falters.

Taking NAD supplements doesn't fix the root cause of why you have low energy levels and why you feel tired.

Also said
“The most critical component of NAD recycling is circadian rhythm alignment because NAMPT the bottleneck in how much NAD gets produced is dependent of SIRT1 expression the protein that governs circadian rhythm regulation.”— Directly states the circadian-NAD link that most people miss.
“If your circadian rhythms are synchronized, then everything in your body works like clockwork. Your hormones and sleepwake cycles are in sync, and you have a lower risk of diabetes and other diseases.”— Expands the benefits beyond energy to metabolic health.

Methylene blue as an emergency mitochondrial bypass, not a daily energy hack

Methylene blue can donate electrons downstream of dysfunctional complexes I and III, but Siim Land found no effect on his healthy mitochondria and warns it's a short-term band-aid only for genuine mitochondrial damage.

Why this matters: Counters the growing interest in methylene blue as a nootropic or energy enhancer by framing it as a medical intervention for broken complexes, not a wellness supplement.

Background

Some biohackers and clinics promote methylene blue for cognition and energy. The speaker explains its actual pharmacological role—bypassing damaged complexes to keep ATP production going when the electron transport chain is impaired.

Methylene blue acts as an alternative electron acceptor, shuttling electrons directly to complex IV, bypassing the need for functional complexes I and III. This can be life-saving in conditions like cyanide poisoning, mitochondrial genetic disorders, or severe neurodegeneration where certain complexes fail. However, if mitochondria are healthy, bypassing complexes does not boost function; it's redundant. Siim Land reports taking it himself and noticing nothing, precisely because his mitochondrial machinery is intact and efficiently producing ATP. He cautions that using it without damaged complexes won't enhance energy and might cause side effects. The takeaway: reserve methylene blue for diagnosed mitochondrial dysfunction, not as a daily performance enhancer.

Personal experience

I've taken methylene blue before, and I didn't notice an effect because my mitochondria are already working optimally.

Methyline blue is an alternative electron donor, and it bypasses the mitochondrial complex one and three, which helps the mitochondria to produce energy during mitochondrial dysfunction when one of the complexes is broken.

Also said
“Methylene blue might come in handy as a short-term band-aid to support energy production when one of these mitochondrial complexes isn't working.”— Reinforces the temporary, damage-specific nature of the intervention.

Cortisol in the morning is essential for energy, not an enemy

A healthy cortisol spike upon waking is necessary to feel energized; low morning cortisol is associated with fatigue and insulin resistance, not just stress.

Why this matters: Pushes back against the popular narrative that cortisol is purely bad, highlighting its physiological necessity for alertness and metabolic health.

Background

Cortisol is widely blamed for stress and belly fat. Land clarifies that the natural diurnal rhythm—high in the morning, low at night—is critical. A blunted morning rise leads to daytime fatigue.

Many people associate cortisol with stress and something bad. But the truth is that if you don't produce enough cortisol in the morning, you're going to feel tired and it's also associated with diabetes and insulin resistance.

High iron accelerates aging through lipofuscin, while low copper often masquerades as iron deficiency

Iron accumulation in lipofuscin drives cellular senescence, yet iron deficiency anemia is frequently caused by insufficient copper to produce ceruloplasmin for iron transport, not just low iron intake.

Why this matters: Offers a nuanced view on iron: men often need to lower iron via blood donation, while women's fatigue may actually stem from copper deficiency, not just iron loss from menstruation.

Background

Conventional wisdom says tiredness plus anemia equals iron deficiency. Land introduces lipofuscin—an age-related pigment that accumulates when autophagy slows, filled with iron that promotes oxidation and zombie cells.

Lipofuscin, the 'wear-and-tear' pigment, builds up in cells when mitophagy and autophagy decline with age. It's rich in iron, which catalyzes free radical damage and triggers cellular senescence (aging cells that don't die but emit inflammatory signals). So high body iron stores accelerate aging. Conversely, many women diagnosed with iron deficiency anemia are actually low in copper, because ceruloplasmin, the copper-containing protein, is needed to absorb and transport iron efficiently. Supplementing iron alone won't fix the root cause if copper is missing. The speaker advises men to consider blood donation to reduce iron overload, while women should ensure both iron and copper intake from foods like liver, dark chocolate, and beans.

High iron levels in the blood promote aging through lipofuskin accumulation and chronic inflammation.

Also said
“Iron deficiency anemia isn't always because of low iron levels. It's more often than not because of low copper.”— Reframes the typical anemia workup to include copper.
“Men might actually need to lower their iron levels with blood donation or iron gulation because high iron levels are associated with heart disease and accelerated aging.”— Specific, actionable advice for men that runs counter to common 'more iron is better' thinking.

Recommendations

Products, supplements, and tools mentioned in the episode

3 items

Nicotinamide (niacinamide) or Niacin

Supplement

Recommended as a more suitable long-term NAD precursor than NMN or NR, because it feeds the salvage pathway via NAMPT. Niacinamide avoids the flush associated with niacin.

Land says that while NMN and NR reliably raise NAD, they don't fix the impaired salvage pathway. Niacinamide, the direct substrate of NAMPT, is better aligned with the body's natural recycling system. He suggests this as part of a broader strategy that includes circadian rhythm alignment, not as a standalone fix. The speaker does not specify a brand or dosage.

vs alternatives

Compared to NMN/NR, these forms are cheaper and may upregulate the salvage pathway rather than bypass it, leading to more sustainable energy.

If you take an NAD supplement then ninamide or nascin are much better and more suitable for long-term NAD production.

Find Nicotinamide

Nicotinamide Mononucleotide (NMN) or Nicotinamide Riboside (NR)

Supplement

These NAD precursors reliably increase NAD levels but only short-term; they do not address the root cause of low energy if the salvage pathway is impaired. Still, they are mentioned as common supplements people use.

vs alternatives

Less favorable than niacinamide for long-term sustainability, but can provide a quick energy lift. Land suggests they are over-relied upon without fixing circadian rhythm.

Taking NAD supplements like NMN and NR will increase your energy levels, and it can give you short-term energy.

Find Nicotinamide

Methylene Blue

Supplement

A medical compound that acts as an alternative electron donor for damaged mitochondria. Not recommended for healthy individuals; Land personally tried it and felt no effect.

vs alternatives

Unlike energy supplements that increase metabolism, methylene blue only helps when complexes are broken; for healthy people, lifestyle changes are superior.

Personal experience

I've taken methylene blue before, and I didn't notice an effect because my mitochondria are already working optimally.

Methylene blue is an alternative electron donor, and it bypasses the mitochondrial complex one and three, which helps the mitochondria to produce energy during mitochondrial dysfunction.

Find Methylene
Disclosed sponsorships1speaker disclosed

Society (Youthban Society)

Service Sponsored · disclosed

An online school community that teaches how to look and feel younger, with 12+ hours of video courses, live Q&A, community support, and personalized protocols. Priced at roughly $1 per day (less with annual plan).

DisclosureCo-founded by Siim Land and his wife Inca; the video includes a promotional segment.

The school covers nutrition, skincare, fitness, sleep, biomarkers, and daily routines. Land and his wife share their own health protocols that put them in the top 1% of biomarkers. The community includes a WhatsApp group, workout plans, and meal plans. Land positions it as a comprehensive, coached solution to achieve top-tier health and energy, complementing the free educational content on his channel.

vs alternatives

Compared to standalone supplements or generic advice, this offers community accountability, live Q&A, and updated protocols from practitioners who have personally tested the methods.

Personal experience

Me and Inca have reached top 1% of health with our biomarkers and we can teach you to accomplish the same because we have already coached over 500 individuals.

My school community with me and my wife is now live. It's called Society and it teaches you how to look and feel younger.

Also said
“All of this for $1 per day, and even less than that with the annual plan.”— Pricing detail.
Find Society

Notable quotes

Lines worth pulling out — contrarian, specific, or perfectly phrased

6 items
Paradoxically, exercising regularly will increase your energy and you'll feel less tired during the daytime. That's because your mitochondria are working more efficiently and you have more mitochondria to begin with.
Encapsulates the counterintuitive truth that expending energy through exercise actually builds more energy capacity.
Caffeine works by blocking adenosine receptors in the brain, masking the feeling of tiredness. You're actually not untired, but your brain just hides the feeling of tiredness.
A clear, memorable explanation that caffeine is a mask, not a cure for fatigue.
Taking NAD supplements doesn't fix the root cause of why you have low energy levels and why you feel tired.
Challenges the multi-million dollar NAD supplement industry, redirecting focus to circadian biology.
The most critical component of NAD recycling is circadian rhythm alignment because NAMPT the bottleneck in how much NAD gets produced is dependent of SIRT1 expression the protein that governs circadian rhythm regulation.
Crystallizes the often-overlooked connection between daily light exposure patterns and biochemical energy recycling.
High iron levels in the blood promote aging through lipofuskin accumulation and chronic inflammation.
Ties a common nutrient (iron) directly to an under-discussed aging process, suggesting that more iron is not always better.
Most people aren't actually night owls. They just have a messed up circadian rhythm because of looking at screens and blue light at night.
A contrarian take that reframes the 'night owl' identity as a symptom of modern light pollution rather than an innate trait.

Sign in to share feedback

Tell us if this brief hit the mark or missed it — feedback feeds back into the next iteration of the prompt.

Topics covered

mitochondriaatpnadsalvage-pathwaycircadian-rhythmcortisolmelatoninexercisehiitmitophagyautophagysleepcaffeineironcopperlipofuscinmethylthionine-chloridesupplementssociety-school
Free account

Make this library yours

Reading is free for everyone. A free account adds the personal layer: save protocols, follow experts, and see how the other experts weigh in on this same topic.

Create a free accountSign in

Where the experts disagree — weekly

One email a week: the sharpest new disagreements and protocols from the library. No spam, unsubscribe anytime.

Educational summary of the cited expert source — not medical advice. Open the source recording linked above and consult a qualified physician before acting on any protocol.